General Information

  • ID:  hor006837
  • Uniprot ID:  O43927??24-109)
  • Protein name:  C-X-C motif chemokine 13
  • Gene name:  TTR
  • Organism:  Homo sapiens
  • Family:  Intercrine alpha (chemokine CxC) family
  • Source:  Human
  • Expression:  Highest levels in liver; followed by spleen; lymph node; appendix and stomach. Low levels in salivary gland; mammary gland and fetal spleen.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0048248 CXCR3 chemokine receptor binding; GO:0031724 CXCR5 chemokine receptor binding; GO:0031735 CCR10 chemokine receptor binding; GO:0017134 fibroblast growth factor binding; GO:0048018 receptor ligand activity; GO:0008009 chemokine activity; GO:0045236 CXCR chemokine receptor binding; GO:0008201 heparin binding
  • GO CC:  GO:0002518 lymphocyte chemotaxis across high endothelial venule; GO:2000545 negative regulation of endothelial cell chemotaxis to fibroblast growth factor; GO:0030593 neutrophil chemotaxis; GO:0033634 positive regulation of cell-cell adhesion mediated by integrin; GO:0002920 regulation of humoral immune response; GO:0090630 activation of GTPase activity; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0007267 cell-cell signaling; GO:0006954 inflammatory response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0033625 positive regulation of integrin activation; GO:0010820 positive regulation of T cell chemotaxis; GO:0071222 cellular response to lipopolysaccharide; GO:0070098 chemokine-mediated signaling pathway; GO:0002544 chronic inflammatory response; GO:0042742 defense response to bacterium; GO:0035768 endothelial cell chemotaxis to fibroblast growth factor; GO:0002467 germinal center formation; GO:0035754 B cell chemo

Sequence Information

  • Sequence:  LEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
  • Length:  86
  • Propeptide:  MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
  • Signal peptide:  MKFISTSLLLMLLVSSLSPVQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA